PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRAES3BF076000070CFD_t1
Common NameTRAES_3BF076000070CFD_c1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 291aa    MW: 30994.9 Da    PI: 7.2093
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRAES3BF076000070CFD_t1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding383.8e-121461148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT.TTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg.kgRtlkqcksrwqkyl 48
                             rg W++eEde+lv++++ +G g+W++++r  g +g ++   ++rw +yl
  TRAES3BF076000070CFD_t1 14 RGLWSPEEDEKLVKYITAHGHGCWSSVPRQAGaQG-CRGAARLRWINYL 61
                             788*****************************866.8888999999986 PP

2Myb_DNA-binding54.91.9e-1767110146
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                              rg++++eE+ l+vd+++ lG++ W+ Ia++++ gRt++++k++w++
  TRAES3BF076000070CFD_t1  67 RGSFSQEEEALIVDLHRVLGNR-WAQIAKHLP-GRTDNEVKNFWNS 110
                              899*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.6E-21664IPR009057Homeodomain-like
PROSITE profilePS5129413.492961IPR017930Myb domain
SuperFamilySSF466893.15E-2412108IPR009057Homeodomain-like
SMARTSM007172.3E-61363IPR001005SANT/Myb domain
PfamPF002493.4E-91461IPR001005SANT/Myb domain
PROSITE profilePS5129426.81162116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.4E-2665117IPR009057Homeodomain-like
SMARTSM007179.8E-1766114IPR001005SANT/Myb domain
PfamPF002492.1E-1567110IPR001005SANT/Myb domain
CDDcd001671.04E-1269109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MGHHSCCNKQ KVRRGLWSPE EDEKLVKYIT AHGHGCWSSV PRQAGAQGCR GAARLRWINY  60
LRPDLKRGSF SQEEEALIVD LHRVLGNRWA QIAKHLPGRT DNEVKNFWNS TIKKKLISQA  120
VGSLHSGNIP SSADLYYNIL DGAGQGIAAA GCASLNGLDN AAQAVATQPP PSSAAWLNFT  180
SQPLLLPVHV PGCDLQYTVD GEFIRLCREA ANACPENGAS SLLAQEGAAD RSCLPVFAEP  240
KGASAFATDP GMGPVADFMD AILGSSSTSA ASVSSVDSFS ANTGMQLHWV P
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-27141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3729260.0AK372926.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3016B12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003569661.11e-138PREDICTED: myb-related protein Myb4-like
SwissprotQ9SPG32e-67MYB26_ARATH; Transcription factor MYB26
TrEMBLA0A077S2N20.0A0A077S2N2_WHEAT; Uncharacterized protein
STRINGMLOC_18177.21e-171(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP128133035
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13890.21e-62myb domain protein 26
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]